Lineage for d2fyuh_ (2fyu H:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027753Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 3027754Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
    automatically mapped to Pfam PF02320
  5. 3027755Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 3027789Protein automated matches [190042] (4 species)
    not a true protein
  7. 3027809Species Cow (Bos taurus) [TaxId:9913] [186764] (7 PDB entries)
  8. 3027812Domain d2fyuh_: 2fyu H: [134402]
    Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyue1, d2fyue2, d2fyuf_, d2fyug_, d2fyui_, d2fyuj_, d2fyuk_
    automated match to d1l0lh_
    complexed with fdn, fes, hem

Details for d2fyuh_

PDB Entry: 2fyu (more details), 2.26 Å

PDB Description: Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
PDB Compounds: (H:) Ubiquinol-cytochrome c reductase complex 11 kDa protein

SCOPe Domain Sequences for d2fyuh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fyuh_ f.28.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahklf
nslk

SCOPe Domain Coordinates for d2fyuh_:

Click to download the PDB-style file with coordinates for d2fyuh_.
(The format of our PDB-style files is described here.)

Timeline for d2fyuh_: