![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
![]() | Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) ![]() location - intermembrane side of the bc1 complex automatically mapped to Pfam PF02320 |
![]() | Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins) "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1 |
![]() | Protein automated matches [190042] (4 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [186764] (7 PDB entries) |
![]() | Domain d2fyuh_: 2fyu H: [134402] Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyue1, d2fyue2, d2fyuf_, d2fyug_, d2fyui_, d2fyuj_, d2fyuk_ automated match to d1l0lh_ complexed with fdn, fes, hem |
PDB Entry: 2fyu (more details), 2.26 Å
SCOPe Domain Sequences for d2fyuh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fyuh_ f.28.1.1 (H:) automated matches {Cow (Bos taurus) [TaxId: 9913]} dplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahklf nslk
Timeline for d2fyuh_: