![]() | Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) ![]() |
![]() | Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (1 protein) |
![]() | Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species) together with cytochrome b binds to ubiquinone |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81503] (18 PDB entries) Uniprot P13271 #SP Uniprot P13271 Uniprot P13271 #SP ! Uniprot P13271 |
![]() | Domain d2fyug1: 2fyu G:1-75 [134401] Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyuf1, d2fyuh1, d2fyui1, d2fyuj1, d2fyuk1 automatically matched to d1be3g_ complexed with fdn, fes, hem |
PDB Entry: 2fyu (more details), 2.26 Å
SCOP Domain Sequences for d2fyug1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fyug1 f.23.13.1 (G:1-75) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt wgtqefekskrknpa
Timeline for d2fyug1: