Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) location - matrix side of the bc1 complex |
Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins) probably important for the complex assembly, caps the matrix face of cytochrome b |
Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [81519] (18 PDB entries) Uniprot P00129 |
Domain d2fyuf1: 2fyu F:5-110 [134400] Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyug_, d2fyuh_, d2fyui1, d2fyuj_, d2fyuk_ automatically matched to d1l0lf_ complexed with fdn, fes, hem |
PDB Entry: 2fyu (more details), 2.26 Å
SCOPe Domain Sequences for d2fyuf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fyuf1 f.27.1.1 (F:5-110) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} avsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikr aldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
Timeline for d2fyuf1: