Lineage for d2fyuf1 (2fyu F:5-110)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1060623Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 1060624Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
  5. 1060625Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 1060626Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)
  7. 1060637Species Cow (Bos taurus) [TaxId:9913] [81519] (18 PDB entries)
    Uniprot P00129
  8. 1060644Domain d2fyuf1: 2fyu F:5-110 [134400]
    Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyug_, d2fyuh_, d2fyui1, d2fyuj_, d2fyuk_
    automatically matched to d1l0lf_
    complexed with fdn, fes, hem

Details for d2fyuf1

PDB Entry: 2fyu (more details), 2.26 Å

PDB Description: Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
PDB Compounds: (F:) Hypothetical protein LOC616871

SCOPe Domain Sequences for d2fyuf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fyuf1 f.27.1.1 (F:5-110) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
avsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikr
aldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

SCOPe Domain Coordinates for d2fyuf1:

Click to download the PDB-style file with coordinates for d2fyuf1.
(The format of our PDB-style files is described here.)

Timeline for d2fyuf1: