SCOPe 2.02: Domain d2fyud1: 2fyu D:1-195

Lineage for d2fyud1 (2fyu D:1-195)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein)

6. Protein Cytochrome bc1 domain [46677] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [46678] (18 PDB entries)
   Uniprot P00125

8. Domain d2fyud1: 2fyu D:1-195 [134398]
   Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud2, d2fyuf_, d2fyug_, d2fyuh_, d2fyui1, d2fyuj_, d2fyuk_
   automatically matched to d1be3d2
   complexed with fdn, fes, hem

Details for d2fyud1

PDB Entry: 2fyu, 2.26 Å

PDB Description: Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor

PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d2fyud1:

Sequence; same for both SEQRES and ATOM records:

>d2fyud1 a.3.1.3 (D:1-195) Cytochrome bc1 domain {Cow (Bos taurus) [TaxId: 9913]}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

Timeline for d2fyud1:

• d2fyud1 first appeared in SCOP 1.73
  
• d2fyud1 appears in SCOPe 2.01
  
• d2fyud1 appears in SCOPe 2.03
  
• d2fyud1 appears in the current release, SCOPe 2.08