Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) |
Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [81643] (17 PDB entries) Uniprot P00157 |
Domain d2fyuc1: 2fyu C:261-379 [134396] Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc2, d2fyud1, d2fyud2, d2fyue1, d2fyue2, d2fyuf_, d2fyug_, d2fyuh_, d2fyui_, d2fyuj_, d2fyuk_ automated match to d1ntmc1 complexed with fdn, fes, hem |
PDB Entry: 2fyu (more details), 2.26 Å
SCOPe Domain Sequences for d2fyuc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fyuc1 f.32.1.1 (C:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]} plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw
Timeline for d2fyuc1: