Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
Family d.185.1.1: MPP-like [63412] (7 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
Protein Cytochrome bc1 core subunit 1 [63408] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [55997] (17 PDB entries) Uniprot P31800 |
Domain d2fyua1: 2fyu A:1-233 [134392] Other proteins in same PDB: d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyue1, d2fyue2, d2fyuf_, d2fyug_, d2fyuh_, d2fyui_, d2fyuj_, d2fyuk_ automated match to d1ntma1 complexed with fdn, fes, hem |
PDB Entry: 2fyu (more details), 2.26 Å
SCOPe Domain Sequences for d2fyua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fyua1 d.185.1.1 (A:1-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]} tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlsp
Timeline for d2fyua1: