Lineage for d2fymc1 (2fym C:140-430)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2445369Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2445370Family c.1.11.1: Enolase [51605] (2 proteins)
    automatically mapped to Pfam PF00113
  6. 2445371Protein Enolase [51606] (10 species)
    Fold of this protein slightly differs from common fold in topology
  7. 2445403Species Escherichia coli [TaxId:562] [69396] (3 PDB entries)
  8. 2445405Domain d2fymc1: 2fym C:140-430 [134381]
    Other proteins in same PDB: d2fyma2, d2fymc2, d2fymd2, d2fymf2
    automatically matched to d1e9id1
    protein/RNA complex; complexed with mg

Details for d2fymc1

PDB Entry: 2fym (more details), 1.6 Å

PDB Description: crystal structure of e. coli enolase complexed with the minimal binding segment of rnase e.
PDB Compounds: (C:) enolase

SCOPe Domain Sequences for d2fymc1:

Sequence, based on SEQRES records: (download)

>d2fymc1 c.1.11.1 (C:140-430) Enolase {Escherichia coli [TaxId: 562]}
pgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvkeairmgsevfhhlakvlkak
gmntavgdeggyapnlgsnaealaviaeavkaagyelgkditlamdcaasefykdgkyvl
agegnkaftseefthfleeltkqypivsiedgldesdwdgfayqtkvlgdkiqlvgddlf
vtntkilkegiekgiansilikfnqigsltetlaaikmakdagytavishrsgetedati
adlavgtaagqiktgsmsrsdrvakynqlirieealgekapyngrkeikgq

Sequence, based on observed residues (ATOM records): (download)

>d2fymc1 c.1.11.1 (C:140-430) Enolase {Escherichia coli [TaxId: 562]}
pgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvkeairmgsevfhhlakvlkak
gmntavgdeggyapnlgsnaealaviaeavkaagyelgkditlamdcaasefykdgkyvl
ageaftseefthfleeltkqypivsiedgldesdwdgfayqtkvlgdkiqlvgddlfvtn
tkilkegiekgiansilikfnqigsltetlaaikmakdagytavishrsgetedatiadl
avgtaagqiktgsmsrsdrvakynqlirieealgekapyngrkeikgq

SCOPe Domain Coordinates for d2fymc1:

Click to download the PDB-style file with coordinates for d2fymc1.
(The format of our PDB-style files is described here.)

Timeline for d2fymc1: