SCOP 1.73: Domain d2fyma1: 2fym A:140-431

Lineage for d2fyma1 (2fym A:140-431)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.1: Enolase [51605] (1 protein)

6. Protein Enolase [51606] (7 species)
   Fold of this protein slightly differs from common fold in topology

7. Species Escherichia coli [TaxId:562] [69396] (2 PDB entries)

8. Domain d2fyma1: 2fym A:140-431 [134379]
   Other proteins in same PDB: d2fyma2, d2fymc2, d2fymd2, d2fymf2
   automatically matched to d1e9id1
   complexed with mg

Details for d2fyma1

PDB Entry: 2fym, 1.6 Å

PDB Description: crystal structure of e. coli enolase complexed with the minimal binding segment of rnase e.

PDB Compounds: (A:) enolase

SCOP Domain Sequences for d2fyma1:

Sequence; same for both SEQRES and ATOM records:

>d2fyma1 c.1.11.1 (A:140-431) Enolase {Escherichia coli [TaxId: 562]}
pgkysmpvpmmniinggehadnnvdiqefmiqpvgaktvkeairmgsevfhhlakvlkak
gmntavgdeggyapnlgsnaealaviaeavkaagyelgkditlamdcaasefykdgkyvl
agegnkaftseefthfleeltkqypivsiedgldesdwdgfayqtkvlgdkiqlvgddlf
vtntkilkegiekgiansilikfnqigsltetlaaikmakdagytavishrsgetedati
adlavgtaagqiktgsmsrsdrvakynqlirieealgekapyngrkeikgqa

Timeline for d2fyma1:

• d2fyma1 is new in SCOP 1.73
  
• d2fyma1 appears in SCOP 1.75
  
• d2fyma1 appears in the current release, SCOPe 2.08