Lineage for d2fydc_ (2fyd C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1887016Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1887017Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1887055Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 1887056Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 1887088Species Mouse (Mus musculus) [TaxId:10090] [69628] (12 PDB entries)
  8. 1887096Domain d2fydc_: 2fyd C: [134367]
    Other proteins in same PDB: d2fydb1, d2fydd_
    automated match to d1nf5a_
    complexed with bgc, ca, mes, mn, nga, pg4, udp

Details for d2fydc_

PDB Entry: 2fyd (more details), 2 Å

PDB Description: catalytic domain of bovine beta 1, 4-galactosyltransferase in complex with alpha-lactalbumin, glucose, mn, and udp-n-acetylgalactosamine
PDB Compounds: (C:) alpha-lactalbumin

SCOPe Domain Sequences for d2fydc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fydc_ d.2.1.2 (C:) alpha-Lactalbumin {Mouse (Mus musculus) [TaxId: 10090]}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

SCOPe Domain Coordinates for d2fydc_:

Click to download the PDB-style file with coordinates for d2fydc_.
(The format of our PDB-style files is described here.)

Timeline for d2fydc_: