| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
| Domain d2fx9i2: 2fx9 I:114-227 [134299] Other proteins in same PDB: d2fx9h1, d2fx9i1, d2fx9l1, d2fx9l2, d2fx9m1, d2fx9m2 automatically matched to d1ngzb2 complexed with orq |
PDB Entry: 2fx9 (more details), 2.1 Å
SCOP Domain Sequences for d2fx9i2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fx9i2 b.1.1.2 (I:114-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
Timeline for d2fx9i2: