Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries) |
Domain d2fx8h1: 2fx8 H:1-113 [134280] Other proteins in same PDB: d2fx8h2, d2fx8i2, d2fx8j2, d2fx8k2, d2fx8l1, d2fx8l2, d2fx8m1, d2fx8m2, d2fx8n1, d2fx8n2, d2fx8o1, d2fx8o2 automatically matched to d1hzhh1 |
PDB Entry: 2fx8 (more details), 2.2 Å
SCOPe Domain Sequences for d2fx8h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fx8h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} qvqlvqsgaevkrpgssvtvsckasggsfstyalswvrqapgrglewmggviplltitny aprfqgrititadrststaylelnslrpedtavyycaregttgwgwlgkpigafahwgqg tlvtvss
Timeline for d2fx8h1: