Lineage for d2fx7l2 (2fx7 L:108-213)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1761687Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1761688Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 1761691Domain d2fx7l2: 2fx7 L:108-213 [134279]
    Other proteins in same PDB: d2fx7h1, d2fx7h2, d2fx7l1
    automatically matched to d1rhha2
    complexed with gol

Details for d2fx7l2

PDB Entry: 2fx7 (more details), 1.76 Å

PDB Description: crystal structure of hiv-1 neutralizing human fab 4e10 in complex with a 16-residue peptide encompassing the 4e10 epitope on gp41
PDB Compounds: (L:) Fab 4E10

SCOPe Domain Sequences for d2fx7l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fx7l2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d2fx7l2:

Click to download the PDB-style file with coordinates for d2fx7l2.
(The format of our PDB-style files is described here.)

Timeline for d2fx7l2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fx7l1