SCOPe 2.03: Domain d2fx6a_: 2fx6 A:

Lineage for d2fx6a_ (2fx6 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (392 PDB entries)
   Uniprot P00760

8. Domain d2fx6a_: 2fx6 A: [134275]
   automated match to d1aq7__
   complexed with 270, ca

Details for d2fx6a_

PDB Entry: 2fx6, 1.57 Å

PDB Description: bovine trypsin complexed with 2-aminobenzamidazole

PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d2fx6a_:

Sequence; same for both SEQRES and ATOM records:

>d2fx6a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d2fx6a_:

• d2fx6a_ first appeared in SCOP 1.73, called d2fx6a1
  
• d2fx6a_ appears in SCOPe 2.02
  
• d2fx6a_ appears in SCOPe 2.04
  
• d2fx6a_ appears in the current release, SCOPe 2.08