Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Species Escherichia coli [TaxId:562] [52627] (10 PDB entries) Uniprot P02990 |
Domain d2fx3a3: 2fx3 A:9-204 [134273] Other proteins in same PDB: d2fx3a1, d2fx3a2 automatically matched to d1ob2a3 complexed with gdp, mg |
PDB Entry: 2fx3 (more details), 3.4 Å
SCOPe Domain Sequences for d2fx3a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fx3a3 c.37.1.8 (A:9-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]} kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki lelagfldsyipeper
Timeline for d2fx3a3: