SCOP 1.75: Domain d2fwob1: 2fwo B:1-99

Lineage for d2fwob1 (2fwo B:1-99)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (91 PDB entries)
   Uniprot P01887

8. Domain d2fwob1: 2fwo B:1-99 [134252]
   Other proteins in same PDB: d2fwoa1, d2fwoa2
   automatically matched to d1bz9b_

Details for d2fwob1

PDB Entry: 2fwo, 2.6 Å

PDB Description: mhc class i h-2kd heavy chain in complex with beta-2microglobulin and peptide derived from influenza nucleoprotein

PDB Compounds: (B:) Beta-2-microglobulin

SCOP Domain Sequences for d2fwob1:

Sequence; same for both SEQRES and ATOM records:

>d2fwob1 b.1.1.2 (B:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d2fwob1:

• d2fwob1 first appeared in SCOP 1.73
  
• d2fwob1 is called d2fwob_ in SCOPe 2.01
  
• d2fwob1 appears in the current release, SCOPe 2.08, called d2fwob_