Lineage for d2fwlb1 (2fwl B:35-168)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 940170Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 940171Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 940642Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)
  6. 940643Protein Cytochrome c oxidase [49544] (4 species)
  7. 940686Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (7 PDB entries)
  8. 940694Domain d2fwlb1: 2fwl B:35-168 [134248]
    Other proteins in same PDB: d2fwla1
    automatically matched to d2cuab_
    complexed with cua, hec

Details for d2fwlb1

PDB Entry: 2fwl (more details)

PDB Description: The cytochrome c552/CuA complex from Thermus thermophilus
PDB Compounds: (B:) Cytochrome c oxidase subunit II

SCOPe Domain Sequences for d2fwlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fwlb1 b.6.1.2 (B:35-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
ytlathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnp
ievpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycg
lghqnmfgtivvke

SCOPe Domain Coordinates for d2fwlb1:

Click to download the PDB-style file with coordinates for d2fwlb1.
(The format of our PDB-style files is described here.)

Timeline for d2fwlb1: