Lineage for d2fwla1 (2fwl A:3-131)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760650Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 760651Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 760652Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 760741Protein Cytochrome c552 [46636] (5 species)
  7. 760773Species Thermus thermophilus [TaxId:274] [46637] (6 PDB entries)
    Uniprot P04164
  8. 760778Domain d2fwla1: 2fwl A:3-131 [134247]
    Other proteins in same PDB: d2fwlb1
    automatically matched to d1c52__
    complexed with cua, hec

Details for d2fwla1

PDB Entry: 2fwl (more details)

PDB Description: The cytochrome c552/CuA complex from Thermus thermophilus
PDB Compounds: (A:) Cytochrome c-552

SCOP Domain Sequences for d2fwla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fwla1 a.3.1.1 (A:3-131) Cytochrome c552 {Thermus thermophilus [TaxId: 274]}
dgakiyaqcagchqqngqgipgafpplaghvaeilakeggreylilvllyglqgqievkg
mkyngvmssfaqlkdeeiaavlnhiatawgdakkvkgfkpftaeevkklrakkltpqqvl
aerkklglk

SCOP Domain Coordinates for d2fwla1:

Click to download the PDB-style file with coordinates for d2fwla1.
(The format of our PDB-style files is described here.)

Timeline for d2fwla1: