SCOP 1.75: Domain d2fwla1: 2fwl A:3-131

Lineage for d2fwla1 (2fwl A:3-131)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein Cytochrome c552 [46636] (5 species)

7. Species Thermus thermophilus [TaxId:274] [46637] (6 PDB entries)
   Uniprot P04164

8. Domain d2fwla1: 2fwl A:3-131 [134247]
   Other proteins in same PDB: d2fwlb1
   automatically matched to d1c52__
   complexed with cua, hec

Details for d2fwla1

PDB Entry: 2fwl

PDB Description: The cytochrome c552/CuA complex from Thermus thermophilus

PDB Compounds: (A:) Cytochrome c-552

SCOP Domain Sequences for d2fwla1:

Sequence; same for both SEQRES and ATOM records:

>d2fwla1 a.3.1.1 (A:3-131) Cytochrome c552 {Thermus thermophilus [TaxId: 274]}
dgakiyaqcagchqqngqgipgafpplaghvaeilakeggreylilvllyglqgqievkg
mkyngvmssfaqlkdeeiaavlnhiatawgdakkvkgfkpftaeevkklrakkltpqqvl
aerkklglk

Timeline for d2fwla1:

• d2fwla1 first appeared in SCOP 1.73
  
• d2fwla1 appears in SCOPe 2.01
  
• d2fwla1 appears in the current release, SCOPe 2.08, called d2fwla_