SCOPe 2.03: Domain d2fw4a_: 2fw4 A:

Lineage for d2fw4a_ (2fw4 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme I [TaxId:9606] [51072] (18 PDB entries)

8. Domain d2fw4a_: 2fw4 A: [134237]
   automated match to d1bzm__
   complexed with his, zn

Details for d2fw4a_

PDB Entry: 2fw4, 2 Å

PDB Description: carbonic anhydrase activators. the first x-ray crystallographic study of an activator of isoform i, structure with l-histidine.

PDB Compounds: (A:) Carbonic anhydrase 1

SCOPe Domain Sequences for d2fw4a_:

Sequence; same for both SEQRES and ATOM records:

>d2fw4a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]}
dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg
hsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw
nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst
llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh
nnrptqplkgrtvrasf

Timeline for d2fw4a_:

• d2fw4a_ first appeared in SCOP 1.73, called d2fw4a1
  
• d2fw4a_ appears in SCOPe 2.02
  
• d2fw4a_ appears in SCOPe 2.04
  
• d2fw4a_ appears in the current release, SCOPe 2.08