SCOPe 2.08: Domain d2fvga2: 2fvg A:1-64,A:149-339

Lineage for d2fvga2 (2fvg A:1-64,A:149-339)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)

6. Protein Endoglucanase TM1049 [142516] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [142517] (1 PDB entry)
   Uniprot Q9X0D9 1-64,149-339

8. Domain d2fvga2: 2fvg A:1-64,A:149-339 [134202]
   Other proteins in same PDB: d2fvga1, d2fvga3
   complexed with edo

Details for d2fvga2

PDB Entry: 2fvg, 2.01 Å

PDB Description: crystal structure of endoglucanase (tm1049) from thermotoga maritima at 2.01 a resolution

PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d2fvga2:

Sequence, based on SEQRES records:

>d2fvga2 c.56.5.4 (A:1-64,A:149-339) Endoglucanase TM1049 {Thermotoga maritima [TaxId: 2336]}
mylkelsmmpgvsgdegkvrdfikskieglvdnlytdvlgnlialkrgrdsskkllvsah
mdevXfvsdyiekngravgkafddragcsvlidvlesgvspaydtyfvftvqeetglrgs
avvveqlkptcaivvetttagdnpeleerkwathlgdgpaitfyhrgyvipkeifqtivd
taknndipfqmkrrtaggtdagryartaygvpagvistparyihspnsiidlndyentkk
likvlveegkivevvs

Sequence, based on observed residues (ATOM records):

>d2fvga2 c.56.5.4 (A:1-64,A:149-339) Endoglucanase TM1049 {Thermotoga maritima [TaxId: 2336]}
mylkelsmmpgvsgdegkvrdfikskieglvdnlytdvlgnlialkrgrdsskkllvsah
mdevXfvsdyiekngravgkafddragcsvlidvlesgvspaydtyfvftvqeesavvve
qlkptcaivvetttagdnpeleerkwathlgdgpaitfyhrgyvipkeifqtivdtaknn
dipfqmkrrtygvpagvistparyihspnsiidlndyentkklikvlveegkivevvs

Timeline for d2fvga2:

• d2fvga2 first appeared in SCOP 1.73
  
• d2fvga2 appears in SCOPe 2.07