Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.300: Kinetochore globular domain-like [143025] (1 superfamily) core: alpha-beta(3)-alpha; variant: alpha-beta(4)-alpha(2) |
Superfamily d.300.1: Kinetochore globular domain [143026] (2 families) swapped heterodimer with the N-terminal helices; Spc24-like subunits have the core fold, whereas Spc25-like subunits have a variant fold |
Family d.300.1.2: Spc24-like [143030] (1 protein) Pfam PF08286 |
Protein Kinetochore protein Spc24 [143031] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143032] (2 PDB entries) Uniprot Q04477 155-213! Uniprot Q04477 156-213 |
Domain d2fv4b1: 2fv4 B:156-213 [134195] Other proteins in same PDB: d2fv4a1 |
PDB Entry: 2fv4 (more details)
SCOPe Domain Sequences for d2fv4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fv4b1 d.300.1.2 (B:156-213) Kinetochore protein Spc24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nenilklklyrslgvildlendqvlinrkndgnidilpldnnlsdfyktkyiwerlgk
Timeline for d2fv4b1: