Lineage for d2fuwb1 (2fuw B:3-173)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 838437Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 838438Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) (S)
  5. 838439Family c.57.1.1: MogA-like [53219] (5 proteins)
  6. 838457Protein MogA [53220] (2 species)
  7. 838461Species Shewanella oneidensis [TaxId:70863] [142541] (3 PDB entries)
    Uniprot Q8EKM7 2-174
  8. 838466Domain d2fuwb1: 2fuw B:3-173 [134188]
    automatically matched to 2F7W A:2-174

Details for d2fuwb1

PDB Entry: 2fuw (more details), 1.9 Å

PDB Description: Crystal structure of Molybdenum cofactor biosynthesis protein Mog from Shewanella oneidensis
PDB Compounds: (B:) Molybdenum cofactor biosynthesis protein

SCOP Domain Sequences for d2fuwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fuwb1 c.57.1.1 (B:3-173) MogA {Shewanella oneidensis [TaxId: 70863]}
kakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikma
deqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqtag
lrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfr

SCOP Domain Coordinates for d2fuwb1:

Click to download the PDB-style file with coordinates for d2fuwb1.
(The format of our PDB-style files is described here.)

Timeline for d2fuwb1: