SCOP 1.75: Domain d2fuwa1: 2fuw A:3-174

Lineage for d2fuwa1 (2fuw A:3-174)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families)

5. Family c.57.1.1: MogA-like [53219] (5 proteins)

6. Protein MogA [53220] (2 species)

7. Species Shewanella oneidensis [TaxId:70863] [142541] (3 PDB entries)
   Uniprot Q8EKM7 2-174

8. Domain d2fuwa1: 2fuw A:3-174 [134187]
   automatically matched to 2F7W A:2-174

Details for d2fuwa1

PDB Entry: 2fuw, 1.9 Å

PDB Description: Crystal structure of Molybdenum cofactor biosynthesis protein Mog from Shewanella oneidensis

PDB Compounds: (A:) Molybdenum cofactor biosynthesis protein

SCOP Domain Sequences for d2fuwa1:

Sequence; same for both SEQRES and ATOM records:

>d2fuwa1 c.57.1.1 (A:3-174) MogA {Shewanella oneidensis [TaxId: 70863]}
kakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikma
deqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqtag
lrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrp

Timeline for d2fuwa1:

• d2fuwa1 first appeared in SCOP 1.73
  
• d2fuwa1 does not appear in SCOPe 2.01