Lineage for d2fumc1 (2fum C:3-277)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 875045Protein Mycobacterial protein kinase PknB, catalytic domain [82793] (1 species)
    OPK group; PKN subfamily; serine/threonine kinase
  7. 875046Species Mycobacterium tuberculosis [TaxId:1773] [82794] (3 PDB entries)
  8. 875052Domain d2fumc1: 2fum C:3-277 [134178]
    automatically matched to d1mrub_
    complexed with mix

Details for d2fumc1

PDB Entry: 2fum (more details), 2.89 Å

PDB Description: Catalytic domain of protein kinase PknB from Mycobacterium tuberculosis in complex with mitoxantrone
PDB Compounds: (C:) Probable serine/threonine-protein kinase pknB

SCOP Domain Sequences for d2fumc1:

Sequence, based on SEQRES records: (download)

>d2fumc1 d.144.1.7 (C:3-277) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]}
tpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqn
aaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviada
cqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiadsgnsvtqtaavigtaqy
lspeqargdsvdarsdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarheg
lsadldavvlkalaknpenryqtaaemradlvrvh

Sequence, based on observed residues (ATOM records): (download)

>d2fumc1 d.144.1.7 (C:3-277) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]}
tpshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqn
aaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviada
cqalnfshqngiihrdvkpanimisatnavkvmdfaqylspeqargdsvdarsdvyslgc
vlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlkalaknpenryq
taaemradlvrvh

SCOP Domain Coordinates for d2fumc1:

Click to download the PDB-style file with coordinates for d2fumc1.
(The format of our PDB-style files is described here.)

Timeline for d2fumc1: