SCOP 1.73: Domain d2fugu1: 2fug U:686-767

Lineage for d2fugu1 (2fug U:686-767)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (3 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
   molybdopterine enzyme

6. Protein NADH-quinone oxidoreductase chain 3, Nqo3, C-terminal domain [141393] (1 species)
   topoisomer of the common fold, lacking the second psi loop

7. Species Thermus thermophilus [TaxId:274] [141394] (1 PDB entry)

8. Domain d2fugu1: 2fug U:686-767 [134164]
   Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1
   automatically matched to 2FUG 3:686-767
   complexed with fes, fmn, sf4

Details for d2fugu1

PDB Entry: 2fug, 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus

PDB Compounds: (U:) NADH-quinone oxidoreductase chain 3

SCOP Domain Sequences for d2fugu1:

Sequence, based on SEQRES records:

>d2fugu1 b.52.2.2 (U:686-767) NADH-quinone oxidoreductase chain 3, Nqo3, C-terminal domain {Thermus thermophilus [TaxId: 274]}
kerkgafylrptmwkahqavgkaqeaaraelwahpetaraealpegaqvavetpfgrvea
rvvhredvpkghlylsalgpaa

Sequence, based on observed residues (ATOM records):

>d2fugu1 b.52.2.2 (U:686-767) NADH-quinone oxidoreductase chain 3, Nqo3, C-terminal domain {Thermus thermophilus [TaxId: 274]}
kerkgafylrptmwkahqavgkaqeaarawahpetaraealpegaqvavetpfgrvearv
vhredvpkghlylsalgpaa

Timeline for d2fugu1:

• d2fugu1 is new in SCOP 1.73
  
• d2fugu1 appears in SCOP 1.75
  
• d2fugu1 appears in the current release, SCOPe 2.08