SCOP 1.73: Domain d2fugs1: 2fug S:334-438

Lineage for d2fugs1 (2fug S:334-438)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.29: Bromodomain-like [47363] (10 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.12: Nqo1C-terminal domain-like [140490] (1 family)
   contains extra C-terminal helix that caps the bundle at one end and Fe4-S4 cluster at the other end

5. Family a.29.12.1: Nqo1C-terminal domain-like [140491] (1 protein)
   PfamB 000336; sequence similarity to the Fe4-S4 ferredoxins in the cluser-binding site

6. Protein NADH-quinone oxidoreductase chain 1, Nqo1 [140492] (1 species)

7. Species Thermus thermophilus [TaxId:274] [140493] (1 PDB entry)

8. Domain d2fugs1: 2fug S:334-438 [134160]
   Other proteins in same PDB: d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1
   automatically matched to 2FUG 1:334-438
   complexed with fes, fmn, sf4

Details for d2fugs1

PDB Entry: 2fug, 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus

PDB Compounds: (S:) NADH-quinone oxidoreductase chain 1

SCOP Domain Sequences for d2fugs1:

Sequence; same for both SEQRES and ATOM records:

>d2fugs1 a.29.12.1 (S:334-438) NADH-quinone oxidoreductase chain 1, Nqo1 {Thermus thermophilus [TaxId: 274]}
rvsmvdamwnltrfyahescgkctpcregvagfmvnlfakigtgqgeekdvenleallpl
iegrsfcpladaavwpvkgslrhfkdqylalarekrpvprpslwr

Timeline for d2fugs1:

• d2fugs1 is new in SCOP 1.73
  
• d2fugs1 appears in SCOP 1.75
  
• d2fugs1 appears in the current release, SCOPe 2.08