Lineage for d2fugk1 (2fug K:3-180)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854369Family c.47.1.21: NQO2-like [142405] (2 proteins)
    complex I 24 kDa subunit; contains 2Fe-2S cluster in the active site; includes extra N-terminal four-helical bundle
    automatically mapped to Pfam PF01257
  6. 1854370Protein NADH-quinone oxidoreductase chain 2, NQO2 [142406] (1 species)
  7. 1854371Species Thermus thermophilus [TaxId:274] [142407] (1 PDB entry)
    Uniprot Q56221 2-179
  8. 1854374Domain d2fugk1: 2fug K:3-180 [134150]
    Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1
    automatically matched to 2FUG 2:3-180
    complexed with fes, fmn, sf4

Details for d2fugk1

PDB Entry: 2fug (more details), 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
PDB Compounds: (K:) NADH-quinone oxidoreductase chain 2

SCOPe Domain Sequences for d2fugk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fugk1 c.47.1.21 (K:3-180) NADH-quinone oxidoreductase chain 2, NQO2 {Thermus thermophilus [TaxId: 274]}
ffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevmg
vasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqkv
eclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve

SCOPe Domain Coordinates for d2fugk1:

Click to download the PDB-style file with coordinates for d2fugk1.
(The format of our PDB-style files is described here.)

Timeline for d2fugk1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1