SCOP 1.73: Domain d2fugj2: 2fug J:7-249

Lineage for d2fugj2 (2fug J:7-249)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.142: Nqo1 FMN-binding domain-like [142018] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.142.1: Nqo1 FMN-binding domain-like [142019] (1 family)

5. Family c.142.1.1: Nqo1 FMN-binding domain-like [142020] (1 protein)
   N-terminal part of Pfam PF01512

6. Protein NADH-quinone oxidoreductase chain 1, Nqo1 [142021] (1 species)

7. Species Thermus thermophilus [TaxId:274] [142022] (1 PDB entry)

8. Domain d2fugj2: 2fug J:7-249 [134148]
   Other proteins in same PDB: d2fug11, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1
   automatically matched to 2FUG 1:7-249
   complexed with fes, fmn, sf4

Details for d2fugj2

PDB Entry: 2fug, 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus

PDB Compounds: (J:) NADH-quinone oxidoreductase chain 1

SCOP Domain Sequences for d2fugj2:

Sequence; same for both SEQRES and ATOM records:

>d2fugj2 c.142.1.1 (J:7-249) NADH-quinone oxidoreductase chain 1, Nqo1 {Thermus thermophilus [TaxId: 274]}
sgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrsglrgrg
gagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmilagyair
atvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagayicgeet
almnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaqmgteqs
kgm

Timeline for d2fugj2:

• d2fugj2 is new in SCOP 1.73
  
• d2fugj2 appears in SCOP 1.75
  
• d2fugj2 appears in the current release, SCOPe 2.08