Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.142: Nqo1 FMN-binding domain-like [142018] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.142.1: Nqo1 FMN-binding domain-like [142019] (1 family) |
Family c.142.1.1: Nqo1 FMN-binding domain-like [142020] (1 protein) N-terminal part of Pfam PF01512 |
Protein NADH-quinone oxidoreductase chain 1, Nqo1 [142021] (1 species) |
Species Thermus thermophilus [TaxId:274] [142022] (1 PDB entry) |
Domain d2fugj2: 2fug J:7-249 [134148] Other proteins in same PDB: d2fug11, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1 automatically matched to 2FUG 1:7-249 complexed with fes, fmn, sf4 |
PDB Entry: 2fug (more details), 3.3 Å
SCOP Domain Sequences for d2fugj2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fugj2 c.142.1.1 (J:7-249) NADH-quinone oxidoreductase chain 1, Nqo1 {Thermus thermophilus [TaxId: 274]} sgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrsglrgrg gagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmilagyair atvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagayicgeet almnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaqmgteqs kgm
Timeline for d2fugj2:
View in 3D Domains from other chains: (mouse over for more information) d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1 |