Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.12: Nqo1C-terminal domain-like [140490] (2 families) contains extra C-terminal helix that caps the bundle at one end and Fe4-S4 cluster at the other end |
Family a.29.12.1: Nqo1C-terminal domain-like [140491] (1 protein) PfamB PB000336; sequence similarity to the Fe4-S4 ferredoxins in the cluser-binding site |
Protein NADH-quinone oxidoreductase chain 1, Nqo1 [140492] (1 species) |
Species Thermus thermophilus [TaxId:274] [140493] (1 PDB entry) Uniprot Q56222 334-438 |
Domain d2fug11: 2fug 1:334-438 [134121] Other proteins in same PDB: d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1 complexed with fes, fmn, sf4 |
PDB Entry: 2fug (more details), 3.3 Å
SCOPe Domain Sequences for d2fug11:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fug11 a.29.12.1 (1:334-438) NADH-quinone oxidoreductase chain 1, Nqo1 {Thermus thermophilus [TaxId: 274]} rvsmvdamwnltrfyahescgkctpcregvagfmvnlfakigtgqgeekdvenleallpl iegrsfcpladaavwpvkgslrhfkdqylalarekrpvprpslwr
Timeline for d2fug11:
View in 3D Domains from other chains: (mouse over for more information) d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1 |