Lineage for d2fug11 (2fug 1:334-438)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487717Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1488485Superfamily a.29.12: Nqo1C-terminal domain-like [140490] (2 families) (S)
    contains extra C-terminal helix that caps the bundle at one end and Fe4-S4 cluster at the other end
  5. 1488486Family a.29.12.1: Nqo1C-terminal domain-like [140491] (1 protein)
    PfamB PB000336; sequence similarity to the Fe4-S4 ferredoxins in the cluser-binding site
  6. 1488487Protein NADH-quinone oxidoreductase chain 1, Nqo1 [140492] (1 species)
  7. 1488488Species Thermus thermophilus [TaxId:274] [140493] (1 PDB entry)
    Uniprot Q56222 334-438
  8. 1488489Domain d2fug11: 2fug 1:334-438 [134121]
    Other proteins in same PDB: d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1
    complexed with fes, fmn, sf4

Details for d2fug11

PDB Entry: 2fug (more details), 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
PDB Compounds: (1:) NADH-quinone oxidoreductase chain 1

SCOPe Domain Sequences for d2fug11:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fug11 a.29.12.1 (1:334-438) NADH-quinone oxidoreductase chain 1, Nqo1 {Thermus thermophilus [TaxId: 274]}
rvsmvdamwnltrfyahescgkctpcregvagfmvnlfakigtgqgeekdvenleallpl
iegrsfcpladaavwpvkgslrhfkdqylalarekrpvprpslwr

SCOPe Domain Coordinates for d2fug11:

Click to download the PDB-style file with coordinates for d2fug11.
(The format of our PDB-style files is described here.)

Timeline for d2fug11:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1