Lineage for d2fu6a_ (2fu6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996667Protein Zn metallo-beta-lactamase [56283] (14 species)
  7. 2996805Species Xanthomonas maltophilia [TaxId:40324] [56286] (13 PDB entries)
  8. 2996820Domain d2fu6a_: 2fu6 A: [134106]
    automated match to d1smla_
    complexed with gol, so4

Details for d2fu6a_

PDB Entry: 2fu6 (more details), 2.05 Å

PDB Description: Zinc-beta-lactamase l1 from stenotrophomonas maltophilia (apo form)
PDB Compounds: (A:) Metallo-beta-lactamase L1

SCOPe Domain Sequences for d2fu6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fu6a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]}
evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
kaltckayadaaeqkfdgqlaketag

SCOPe Domain Coordinates for d2fu6a_:

Click to download the PDB-style file with coordinates for d2fu6a_.
(The format of our PDB-style files is described here.)

Timeline for d2fu6a_: