SCOPe 2.06: Domain d2fu5a1: 2fu5 A:11-123

Lineage for d2fu5a1 (2fu5 A:11-123)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.88: Mss4-like [51315] (2 superfamilies)
   complex fold made of several coiled beta-sheets

4. Superfamily b.88.1: Mss4-like [51316] (5 families)
   duplication: tandem repeat of two similar structural motifs

5. Family b.88.1.1: RabGEF Mss4 [51317] (1 protein)
   contains zinc-binding site
   automatically mapped to Pfam PF04421

6. Protein RabGEF Mss4 [51318] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51320] (2 PDB entries)

8. Domain d2fu5a1: 2fu5 A:11-123 [134102]
   Other proteins in same PDB: d2fu5a2, d2fu5b3, d2fu5c1, d2fu5d_
   complexed with bme, zn

Details for d2fu5a1

PDB Entry: 2fu5, 2 Å

PDB Description: structure of rab8 in complex with mss4

PDB Compounds: (A:) Guanine nucleotide exchange factor MSS4

SCOPe Domain Sequences for d2fu5a1:

Sequence, based on SEQRES records:

>d2fu5a1 b.88.1.1 (A:11-123) RabGEF Mss4 {Human (Homo sapiens) [TaxId: 9606]}
vsaegrnrkavlcqrcgsrvlqpgtalfsrrqlflpsmrkkpalsdgsnpdgdllqehwl
vedmfifenvgftkdvgnikflvcadceigpigwhclddknsfyvalervshe

Sequence, based on observed residues (ATOM records):

>d2fu5a1 b.88.1.1 (A:11-123) RabGEF Mss4 {Human (Homo sapiens) [TaxId: 9606]}
vsaegrnrkavlcqrcgsrvlqpgtalfsrrqlflpsmrkdgdllqehwlvedmfifenv
gftkdvgnikflvcadceigpigwhclddknsfyvalervshe

Timeline for d2fu5a1:

• d2fu5a1 first appeared in SCOP 1.73
  
• d2fu5a1 appears in SCOPe 2.05
  
• d2fu5a1 appears in SCOPe 2.07
  
• d2fu5a1 appears in the current release, SCOPe 2.08