Lineage for d2fsed2 (2fse D:4-92)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2183548Protein automated matches [191280] (4 species)
    not a true protein
  7. 2183612Species Mouse (Mus musculus) [TaxId:10090] [225821] (6 PDB entries)
  8. 2183621Domain d2fsed2: 2fse D:4-92 [134024]
    Other proteins in same PDB: d2fsea1, d2fseb1, d2fsec1, d2fsed1
    automated match to d1klub2

Details for d2fsed2

PDB Entry: 2fse (more details), 3.1 Å

PDB Description: crystallographic structure of a rheumatoid arthritis mhc susceptibility allele, hla-dr1 (drb1*0101), complexed with the immunodominant determinant of human type ii collagen
PDB Compounds: (D:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2fsed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fsed2 d.19.1.1 (D:4-92) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywns
qkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d2fsed2:

Click to download the PDB-style file with coordinates for d2fsed2.
(The format of our PDB-style files is described here.)

Timeline for d2fsed2: