Lineage for d2fsed2 (2fse D:5-92)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198561Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1198614Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (12 PDB entries)
  8. 1198632Domain d2fsed2: 2fse D:5-92 [134024]
    Other proteins in same PDB: d2fsea1, d2fsea2, d2fseb1, d2fsec1, d2fsec2, d2fsed1
    automatically matched to d1d5xb2

Details for d2fsed2

PDB Entry: 2fse (more details), 3.1 Å

PDB Description: crystallographic structure of a rheumatoid arthritis mhc susceptibility allele, hla-dr1 (drb1*0101), complexed with the immunodominant determinant of human type ii collagen
PDB Compounds: (D:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2fsed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fsed2 d.19.1.1 (D:5-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
prflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywnsq
kdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d2fsed2:

Click to download the PDB-style file with coordinates for d2fsed2.
(The format of our PDB-style files is described here.)

Timeline for d2fsed2: