SCOPe 2.02: Domain d2fsed1: 2fse D:93-189

Lineage for d2fsed1 (2fse D:93-189)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (39 PDB entries)
   Uniprot P04229 30-219
   probably orthologous to the mouse I-E group

8. Domain d2fsed1: 2fse D:93-189 [134023]
   Other proteins in same PDB: d2fsea1, d2fsea2, d2fseb2, d2fsec1, d2fsec2, d2fsed2
   automatically matched to d1d5xb1

Details for d2fsed1

PDB Entry: 2fse, 3.1 Å

PDB Description: crystallographic structure of a rheumatoid arthritis mhc susceptibility allele, hla-dr1 (drb1*0101), complexed with the immunodominant determinant of human type ii collagen

PDB Compounds: (D:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2fsed1:

Sequence; same for both SEQRES and ATOM records:

>d2fsed1 b.1.1.2 (D:93-189) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrveptvtvyptktqplqhhnllvcsvsdfypgnievrwfrngkeeetgivstglvrngd
wtfqtlvmletvpqsgevytcqvehpsltdpvtvewk

Timeline for d2fsed1:

• d2fsed1 first appeared in SCOP 1.73
  
• d2fsed1 appears in SCOPe 2.01
  
• d2fsed1 appears in SCOPe 2.03
  
• d2fsed1 appears in the current release, SCOPe 2.08