Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (39 PDB entries) Uniprot P04229 30-219 probably orthologous to the mouse I-E group |
Domain d2fsed1: 2fse D:93-189 [134023] Other proteins in same PDB: d2fsea1, d2fsea2, d2fseb2, d2fsec1, d2fsec2, d2fsed2 automatically matched to d1d5xb1 |
PDB Entry: 2fse (more details), 3.1 Å
SCOP Domain Sequences for d2fsed1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fsed1 b.1.1.2 (D:93-189) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} rrveptvtvyptktqplqhhnllvcsvsdfypgnievrwfrngkeeetgivstglvrngd wtfqtlvmletvpqsgevytcqvehpsltdpvtvewk
Timeline for d2fsed1: