SCOP 1.73: Domain d2fseb2: 2fse B:5-92

Lineage for d2fseb2 (2fse B:5-92)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)

7. Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (12 PDB entries)

8. Domain d2fseb2: 2fse B:5-92 [134020]
   Other proteins in same PDB: d2fsea1, d2fsea2, d2fseb1, d2fsec1, d2fsec2, d2fsed1
   automatically matched to d1d5xb2

Details for d2fseb2

PDB Entry: 2fse, 3.1 Å

PDB Description: crystallographic structure of a rheumatoid arthritis mhc susceptibility allele, hla-dr1 (drb1*0101), complexed with the immunodominant determinant of human type ii collagen

PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOP Domain Sequences for d2fseb2:

Sequence; same for both SEQRES and ATOM records:

>d2fseb2 d.19.1.1 (B:5-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
prflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywnsq
kdlleqrraavdtycrhnygvgesftvq

Timeline for d2fseb2:

• d2fseb2 is new in SCOP 1.73
  
• d2fseb2 appears in SCOP 1.75
  
• d2fseb2 appears in the current release, SCOPe 2.08