Lineage for d2fseb1 (2fse B:93-190)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654956Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 654964Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (38 PDB entries)
    probably orthologous to the mouse I-E group
  8. 655011Domain d2fseb1: 2fse B:93-190 [134019]
    Other proteins in same PDB: d2fsea1, d2fsea2, d2fseb2, d2fsec1, d2fsec2, d2fsed2
    automatically matched to d1d5xb1

Details for d2fseb1

PDB Entry: 2fse (more details), 3.1 Å

PDB Description: crystallographic structure of a rheumatoid arthritis mhc susceptibility allele, hla-dr1 (drb1*0101), complexed with the immunodominant determinant of human type ii collagen
PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOP Domain Sequences for d2fseb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fseb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrveptvtvyptktqplqhhnllvcsvsdfypgnievrwfrngkeeetgivstglvrngd
wtfqtlvmletvpqsgevytcqvehpsltdpvtvewka

SCOP Domain Coordinates for d2fseb1:

Click to download the PDB-style file with coordinates for d2fseb1.
(The format of our PDB-style files is described here.)

Timeline for d2fseb1: