Lineage for d2fsea1 (2fse A:83-181)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654849Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 654899Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (20 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 654923Domain d2fsea1: 2fse A:83-181 [134017]
    Other proteins in same PDB: d2fsea2, d2fseb1, d2fseb2, d2fsec2, d2fsed1, d2fsed2
    automatically matched to d1k2da1

Details for d2fsea1

PDB Entry: 2fse (more details), 3.1 Å

PDB Description: crystallographic structure of a rheumatoid arthritis mhc susceptibility allele, hla-dr1 (drb1*0101), complexed with the immunodominant determinant of human type ii collagen
PDB Compounds: (A:) H-2 class II histocompatibility antigen, E-K alpha chain

SCOP Domain Sequences for d2fsea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fsea1 b.1.1.2 (A:83-181) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tnvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprdd
hlfrkfhyltflpstddfydcevdhwgleeplrkhwefe

SCOP Domain Coordinates for d2fsea1:

Click to download the PDB-style file with coordinates for d2fsea1.
(The format of our PDB-style files is described here.)

Timeline for d2fsea1: