Class a: All alpha proteins [46456] (258 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (1 family) |
Family a.104.1.1: Cytochrome P450 [48265] (21 proteins) |
Protein Cytochrome P450-CAM [48266] (1 species) |
Species Pseudomonas putida [TaxId:303] [48267] (57 PDB entries) |
Domain d2frza1: 2frz A:10-414 [134001] automatically matched to d1j51a_ complexed with hem, k; mutant |
PDB Entry: 2frz (more details), 2.1 Å
SCOP Domain Sequences for d2frza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2frza1 a.104.1.1 (A:10-414) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq lireayedyrhfssecpwipreageafdfiptsmdppeqrqfralanqvvgmpvvdklen riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcgllllgg ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
Timeline for d2frza1: