Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
Protein Pleiotropic regulator of virulence genes, SarA [48292] (1 species) closely related to SarR but adopts a different fold; possible experimental artifact? |
Species Staphylococcus aureus [TaxId:1280] [48293] (3 PDB entries) |
Domain d2frhb2: 2frh B:102-224 [133989] Other proteins in same PDB: d2frha3, d2frhb3 automated match to d1fzpb_ complexed with ca |
PDB Entry: 2frh (more details), 2.5 Å
SCOPe Domain Sequences for d2frhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2frhb2 a.4.5.28 (B:102-224) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdiinhln ykqpqvvkavkilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrvnkriteanne iel
Timeline for d2frhb2: