Lineage for d2fq3a1 (2fq3 A:311-395)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981564Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1982415Family a.4.1.18: SWIRM domain [140222] (4 proteins)
    Pfam PF04433; contains extra N-terminal helix
  6. 1982446Protein Transcription regulatory protein swi3 [140223] (1 species)
  7. 1982447Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140224] (1 PDB entry)
    Uniprot P32591 311-395
  8. 1982448Domain d2fq3a1: 2fq3 A:311-395 [133936]

Details for d2fq3a1

PDB Entry: 2fq3 (more details), 1.4 Å

PDB Description: Structure and function of the SWIRM domain, a conserved protein module found in chromatin regulatory complexes
PDB Compounds: (A:) Transcription regulatory protein SWI3

SCOPe Domain Sequences for d2fq3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fq3a1 a.4.1.18 (A:311-395) Transcription regulatory protein swi3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
skwfnlekihsievqslpefftnripsktpevymryrnfmvnsyrlnpneyfsvttarrn
vsgdaaalfrlhkfltkwglinyqv

SCOPe Domain Coordinates for d2fq3a1:

Click to download the PDB-style file with coordinates for d2fq3a1.
(The format of our PDB-style files is described here.)

Timeline for d2fq3a1: