SCOPe 2.04: Domain d2fq3a1: 2fq3 A:311-395

Lineage for d2fq3a1 (2fq3 A:311-395)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.18: SWIRM domain [140222] (4 proteins)
   Pfam PF04433; contains extra N-terminal helix

6. Protein Transcription regulatory protein swi3 [140223] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140224] (1 PDB entry)
   Uniprot P32591 311-395

8. Domain d2fq3a1: 2fq3 A:311-395 [133936]

Details for d2fq3a1

PDB Entry: 2fq3, 1.4 Å

PDB Description: Structure and function of the SWIRM domain, a conserved protein module found in chromatin regulatory complexes

PDB Compounds: (A:) Transcription regulatory protein SWI3

SCOPe Domain Sequences for d2fq3a1:

Sequence; same for both SEQRES and ATOM records:

>d2fq3a1 a.4.1.18 (A:311-395) Transcription regulatory protein swi3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
skwfnlekihsievqslpefftnripsktpevymryrnfmvnsyrlnpneyfsvttarrn
vsgdaaalfrlhkfltkwglinyqv

Timeline for d2fq3a1:

• d2fq3a1 first appeared in SCOP 1.73
  
• d2fq3a1 appears in SCOPe 2.03
  
• d2fq3a1 appears in SCOPe 2.05
  
• d2fq3a1 appears in the current release, SCOPe 2.08