SCOP 1.73: Domain d2fppa2: 2fpp A:131-306

Lineage for d2fppa2 (2fpp A:131-306)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family)

5. Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
   contain additional N-terminal strand "0", antiparallel to strand 2

6. Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [52214] (6 PDB entries)

8. Domain d2fppa2: 2fpp A:131-306 [133916]
   Other proteins in same PDB: d2fppa1, d2fppb1, d2fppb2
   automatically matched to d1euca2
   complexed with cl, so4

Details for d2fppa2

PDB Entry: 2fpp, 2.35 Å

PDB Description: crystal structure of pig gtp-specific succinyl-coa synthetase from polyethylene glycol with chloride ions

PDB Compounds: (A:) Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial

SCOP Domain Sequences for d2fppa2:

Sequence; same for both SEQRES and ATOM records:

>d2fppa2 c.23.4.1 (A:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp
fngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskpvvsfiaglt
appgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefekrkml

Timeline for d2fppa2:

• d2fppa2 is new in SCOP 1.73
  
• d2fppa2 appears in SCOP 1.75
  
• d2fppa2 appears in the current release, SCOPe 2.08