Lineage for d2fpib2 (2fpi B:1-245)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873884Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 873885Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (9 families) (S)
  5. 874071Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
  6. 874072Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)
  7. 874098Species Pig (Sus scrofa) [TaxId:9823] [56084] (6 PDB entries)
    GTP-specific enzyme
  8. 874104Domain d2fpib2: 2fpi B:1-245 [133907]
    Other proteins in same PDB: d2fpia1, d2fpia2, d2fpib1
    automatically matched to d1eucb2
    complexed with so4

Details for d2fpib2

PDB Entry: 2fpi (more details), 2.7 Å

PDB Description: crystal structure of pig gtp-specific succinyl-coa synthetase from polyethylene glycol
PDB Compounds: (B:) Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial

SCOP Domain Sequences for d2fpib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fpib2 d.142.1.4 (B:1-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs
sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl
qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
dksen

SCOP Domain Coordinates for d2fpib2:

Click to download the PDB-style file with coordinates for d2fpib2.
(The format of our PDB-style files is described here.)

Timeline for d2fpib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fpib1