Lineage for d2fpib1 (2fpi B:246-393)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1158469Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) (S)
  5. 1158470Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 1158512Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species)
  7. 1158538Species Pig (Sus scrofa) [TaxId:9823] [52217] (6 PDB entries)
  8. 1158543Domain d2fpib1: 2fpi B:246-393 [133906]
    Other proteins in same PDB: d2fpia1, d2fpia2, d2fpib2
    automatically matched to d1eudb1
    complexed with so4

Details for d2fpib1

PDB Entry: 2fpi (more details), 2.7 Å

PDB Description: crystal structure of pig gtp-specific succinyl-coa synthetase from polyethylene glycol
PDB Compounds: (B:) Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial

SCOPe Domain Sequences for d2fpib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fpib1 c.23.4.1 (B:246-393) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
epieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggvkesqv
yqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtnvheaq
niltnsglpitsavdledaakkavasvt

SCOPe Domain Coordinates for d2fpib1:

Click to download the PDB-style file with coordinates for d2fpib1.
(The format of our PDB-style files is described here.)

Timeline for d2fpib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fpib2