Lineage for d2fpia2 (2fpi A:131-306)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1838358Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 1838359Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 1838366Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (5 species)
  7. 1838396Species Pig (Sus scrofa) [TaxId:9823] [52214] (7 PDB entries)
  8. 1838402Domain d2fpia2: 2fpi A:131-306 [133905]
    Other proteins in same PDB: d2fpia1, d2fpib1, d2fpib2
    automated match to d1euda2
    complexed with so4

Details for d2fpia2

PDB Entry: 2fpi (more details), 2.7 Å

PDB Description: crystal structure of pig gtp-specific succinyl-coa synthetase from polyethylene glycol
PDB Compounds: (A:) Succinyl-CoA ligase [GDP-forming] alpha-chain, mitochondrial

SCOPe Domain Sequences for d2fpia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fpia2 c.23.4.1 (A:131-306) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
ncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqslcvgiggdp
fngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskpvvsfiaglt
appgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefekrkml

SCOPe Domain Coordinates for d2fpia2:

Click to download the PDB-style file with coordinates for d2fpia2.
(The format of our PDB-style files is described here.)

Timeline for d2fpia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fpia1