Lineage for d2fpgb2 (2fpg B:1-245)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1928430Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1928431Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1928670Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
    automatically mapped to Pfam PF13549
    automatically mapped to Pfam PF08442
  6. 1928671Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)
  7. 1928697Species Pig (Sus scrofa) [TaxId:9823] [56084] (7 PDB entries)
    GTP-specific enzyme
  8. 1928704Domain d2fpgb2: 2fpg B:1-245 [133903]
    Other proteins in same PDB: d2fpga1, d2fpga2, d2fpgb1
    automated match to d1eudb2
    complexed with gdp, k, po4

Details for d2fpgb2

PDB Entry: 2fpg (more details), 2.96 Å

PDB Description: crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gdp
PDB Compounds: (B:) Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial

SCOPe Domain Sequences for d2fpgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fpgb2 d.142.1.4 (B:1-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs
sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl
qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
dksen

SCOPe Domain Coordinates for d2fpgb2:

Click to download the PDB-style file with coordinates for d2fpgb2.
(The format of our PDB-style files is described here.)

Timeline for d2fpgb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fpgb1