SCOPe 2.04: Domain d2fpgb2: 2fpg B:1-245

Lineage for d2fpgb2 (2fpg B:1-245)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families)

5. Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
   automatically mapped to Pfam PF13549
   automatically mapped to Pfam PF08442

6. Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [56084] (6 PDB entries)
   GTP-specific enzyme

8. Domain d2fpgb2: 2fpg B:1-245 [133903]
   Other proteins in same PDB: d2fpga1, d2fpga2, d2fpgb1
   automated match to d1eudb2
   complexed with gdp, k, po4

Details for d2fpgb2

PDB Entry: 2fpg, 2.96 Å

PDB Description: crystal structure of pig gtp-specific succinyl-coa synthetase in complex with gdp

PDB Compounds: (B:) Succinyl-CoA ligase [GDP-forming] beta-chain, mitochondrial

SCOPe Domain Sequences for d2fpgb2:

Sequence; same for both SEQRES and ATOM records:

>d2fpgb2 d.142.1.4 (B:1-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs
sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl
qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
dksen

Timeline for d2fpgb2:

• d2fpgb2 first appeared in SCOP 1.73
  
• d2fpgb2 appears in SCOPe 2.03
  
• d2fpgb2 appears in SCOPe 2.05
  
• d2fpgb2 appears in the current release, SCOPe 2.08