Class b: All beta proteins [48724] (165 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.3: Viral proteases [50596] (4 proteins) beta sheet in the first domain is opened rather than forms a barrel |
Protein NS3 protease [50600] (3 species) |
Species West nile virus [TaxId:11082] [141386] (1 PDB entry) |
Domain d2fp7b1: 2fp7 B:19-170 [133899] complexed with NS2B cofactor complexed with ndl |
PDB Entry: 2fp7 (more details), 1.68 Å
SCOP Domain Sequences for d2fp7b1:
Sequence, based on SEQRES records: (download)
>d2fp7b1 b.47.1.3 (B:19-170) NS3 protease {West nile virus [TaxId: 11082]} ttgvyrimtrgllgsyqagagvmvegvfhtlwhttkgaalmsgegrldpywgsvkedrlc yggpwklqhkwnghdevqmivvepgknvknvqtkpgvfktpegeigavtldyptgtsgsp ivdkngdviglygngvimpngsyisaivqger
>d2fp7b1 b.47.1.3 (B:19-170) NS3 protease {West nile virus [TaxId: 11082]} ttgvyrimtsyqagagvmvegvfhtlwhttkgaalmsgegrldpywgsvkedrlcyggpw klqhkwnghdevqmivvepgknvknvqtkpgvfktpegeigavtldyptgtsgspivdkn gdviglygngvimpngsyisaivqger
Timeline for d2fp7b1: