Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) |
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins) contain additional N-terminal strand "0", antiparallel to strand 2 |
Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (2 species) |
Species Pig (Sus scrofa) [TaxId:9823] [52217] (6 PDB entries) |
Domain d2fp4b1: 2fp4 B:246-393 [133897] Other proteins in same PDB: d2fp4a1, d2fp4a2, d2fp4b2 automatically matched to d1eudb1 complexed with gtp, k, mg |
PDB Entry: 2fp4 (more details), 2.08 Å
SCOP Domain Sequences for d2fp4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fp4b1 c.23.4.1 (B:246-393) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} epieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggvkesqv yqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtnvheaq niltnsglpitsavdledaakkavasvt
Timeline for d2fp4b1: